PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G01150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 281aa    MW: 31541.7 Da    PI: 6.7802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G01150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.8e-144592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  OMERI05G01150.1 45 KGPWTEQEDVQLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 92
                     79********************************************97 PP

2Myb_DNA-binding50.93.7e-1698143148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr T++E+ l+++++ q+G++ W++Iar ++ gRt++++k++w++++
  OMERI05G01150.1  98 RGRITADEERLILHLHSQWGSR-WSRIARSLP-GRTDNEIKNFWRTHM 143
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0824092IPR017930Myb domain
SuperFamilySSF466892.9E-2742139IPR009057Homeodomain-like
SMARTSM007171.8E-124494IPR001005SANT/Myb domain
PfamPF002497.0E-134592IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-194699IPR009057Homeodomain-like
CDDcd001676.73E-94792No hitNo description
PROSITE profilePS5129422.89493147IPR017930Myb domain
SMARTSM007177.0E-1597145IPR001005SANT/Myb domain
PfamPF002491.0E-1398142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-22100145IPR009057Homeodomain-like
CDDcd001676.89E-10102143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MAEEEMMMGM MCGSGGNEMM KTKMKKKSRE EGEEEEVSGG GRMRKGPWTE QEDVQLVWFV  60
RLFGERRWDF LAKVSGLKRT GKSCRLRWVN YLHPGLKRGR ITADEERLIL HLHSQWGSRW  120
SRIARSLPGR TDNEIKNFWR THMRKIAHHA KKKINTPSPA PTTSSGSLSS SLTSTTTTAT  180
TTMATAAALQ ESSSCCGGDD EAVDQLVAAA TTPASQLQTM DYTMDQLWND IAAAEADTSC  240
YDAVAAVMAS PPSPVWEFCT DYSLWRIDDE EYYKKMLDAS Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-26451454103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0939210.0AC093921.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0041A22, complete sequence.
GenBankAC1085040.0AC108504.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1654_B10, complete sequence.
GenBankAK1116340.0AK111634.1 Oryza sativa Japonica Group cDNA clone:J013119H17, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639553.11e-119PREDICTED: transcription factor MYB48
SwissprotQ4JL762e-66MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0E0DL460.0A0A0E0DL46_9ORYZ; Uncharacterized protein
STRINGBGIOSGA019054-PA1e-151(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-61myb domain protein 59